PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010933504.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 376aa    MW: 42472 Da    PI: 6.019
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010933504.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1713.8e-5361331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtd+elv +yLk+kv+g k+el evi+ +d+yk+ePw+Lp k  + ++++ew+fF++rd+ky++g+r+nrat sgyWkatgkd++++
  XP_010933504.1   6 LPPGFRFHPTDDELVGYYLKRKVDGLKIEL-EVIPVIDLYKFEPWELPdKsFLPKRDREWFFFCPRDRKYPNGSRTNRATGSGYWKATGKDRKIV 99 
                     79****************************.99**************96445566899************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + + ++ gl+ktLvfy+grap ge+tdWvmheyrl
  XP_010933504.1 100 C-EPSVHGLRKTLVFYHGRAPGGERTDWVMHEYRL 133
                     *.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-613155IPR003441NAC domain
PROSITE profilePS5100557.1366156IPR003441NAC domain
PfamPF023655.7E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MSPMSLPPGF RFHPTDDELV GYYLKRKVDG LKIELEVIPV IDLYKFEPWE LPDKSFLPKR  60
DREWFFFCPR DRKYPNGSRT NRATGSGYWK ATGKDRKIVC EPSVHGLRKT LVFYHGRAPG  120
GERTDWVMHE YRLCEDLSQG ALNFVGAFAL CRIVKRHDHG QKIGDLQGES KAKKVCSSSM  180
IGFSQKRCFN EVGSTSEENQ SIMTDMLTRS NGSTRISSPE NRRGSGLHQI LIDSDQKDFS  240
ESHVSDASKV SSPKEEISES VIATMFPNSI EICAPCHLSP MSSYTNSREE ASMIDELNGH  300
GCCSSFPSSA YCMDMYNNVE DITFPSLAWD TPELMSASFR GIETWNPMLS PSICRQASEG  360
EEANLWLQED SMVIMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D9e-57116215174NAC domain-containing protein 19
3swp_C9e-57116215174NAC domain-containing protein 19
3swp_B9e-57116215174NAC domain-containing protein 19
3swp_A9e-57116215174NAC domain-containing protein 19
3swm_D9e-57116215174NAC domain-containing protein 19
3swm_C9e-57116215174NAC domain-containing protein 19
3swm_B9e-57116215174NAC domain-containing protein 19
3swm_A9e-57116215174NAC domain-containing protein 19
4dul_B9e-57116212171NAC domain-containing protein 19
4dul_A9e-57116212171NAC domain-containing protein 19
1ut7_B9e-57116212171NO APICAL MERISTEM PROTEIN
1ut7_A9e-57116212171NO APICAL MERISTEM PROTEIN
1ut4_B9e-57116212171NO APICAL MERISTEM PROTEIN
1ut4_A9e-57116212171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010933504.10.0PREDICTED: NAC domain-containing protein 45-like
RefseqXP_010933505.10.0PREDICTED: NAC domain-containing protein 45-like
TrEMBLM0RT581e-138M0RT58_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P17780_0011e-138(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-85NAC domain containing protein 71